Generated by Rank Math SEO, this is an llms.txt file designed to help LLMs better understand and index this website.

# Nationwide Peptides: Cutting-edge Peptide research with reliable, science-driven solutions.

## Sitemaps
[XML Sitemap](https://www.nationwidepeptides.com/sitemap_index.xml): Includes all crawlable and indexable pages.

## Posts
- [Your Ultimate Retatrutide Peptide Research Guide: GLP Pathways, Structure & Scientific Studies](https://www.nationwidepeptides.com/retatrutide-peptide-research-guide/): Retatrutide Research Studies
- [TB-500 Peptide Ultimate Research Guide: Thymosin Beta-4, Mechanisms & Scientific Studies](https://www.nationwidepeptides.com/tb-500-peptide-research-guide/): Research involving TB 500 peptides contributes to broader understanding of synthetic peptide structures, signaling pathways, and peptide-related biological systems.
- [BPC-157 Peptide Research Guide: Molecular Pathways, Scientific Studies & Analysis](https://www.nationwidepeptides.com/bpc-157-peptide-research-guide/): The BPC-157 peptide has become one of the most widely researched synthetic peptides due to scientific interest in its molecular structure, peptide stability characteristics, and biological signaling pathways observed in experimental models.

## Pages
- [Shipping and Payments](https://www.nationwidepeptides.com/shipping-and-payments/): Home
- [Reference peptides](https://www.nationwidepeptides.com/peptides-reference/): Home
- [Terms and Conditions](https://www.nationwidepeptides.com/terms-and-conditions/): Nationwide Peptides maintains rigorous standards of transparency and compliance in the provision of research-grade peptides. Access to this website and placement of orders constitute full acceptance of these Terms and Conditions.
- [COAs](https://www.nationwidepeptides.com/coa/): Nationwide Peptides provides batch-specific Certificates of Analysis (COAs) for research peptides through independent third-party laboratory testing performed by Freedom Diagnostics Testing.
- [FAQ](https://www.nationwidepeptides.com/faq/): Peptides are short chains of amino acids used extensively in laboratory settings. Investigators employ them in vitro and in pre-clinical models to explore cell signaling, receptor interactions, protein folding, and metabolic pathways.
- [Peptide Research](https://www.nationwidepeptides.com/peptide-research/): Peptide Research All Bone & Joint Health Research Cognitive & Brain Research Fertility Research Fat Loss & Metabolism Immune & Inflammation Research Longevity & Anti-Aging Research Muscle Growth New & Experimental Peptides Reproductive Health Research Skin, Hair & Collagen Research Sleep & Recovery Research Wound Healing & Tissue Repair Research By Isaac February 18, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 17, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 12, 2026 Read More By Isaac February 12, 2026 Read More By Isaac February 12, 2026 Read More Previous
Page1
Page2
Page3
Page4
Page5
Next By Isaac February 18, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 17, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 12, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 17, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 12, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 17, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 12, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 17, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 12, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 17, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 12, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 17, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 12, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 17, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 12, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 17, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 12, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 17, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 12, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 17, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 12, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 17, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 12, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 18, 2026 Read More By Isaac February 17, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 16, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 15, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 14, 2026 Read More By Isaac February 12, 2026 Read More
- [Checkout](https://www.nationwidepeptides.com/checkout/)
- [Cart](https://www.nationwidepeptides.com/cart/): Your cart is currently empty. Return to shop
- [My Account](https://www.nationwidepeptides.com/my-account/): Home
- [WishSuite](https://www.nationwidepeptides.com/wishsuite/)
- [Reference](https://www.nationwidepeptides.com/reference/): Research articles synthesize key findings from established sources:
- [Know About Research Peptides](https://www.nationwidepeptides.com/about-research-peptides/): Reliable scientific research depends on consistency, transparency, and access to accurately documented materials. High-quality research peptides require strict quality control processes designed to verify identity, composition, and analytical characteristics.
- [Refund and Returns Policy](https://www.nationwidepeptides.com/refund_returns/): Refunds & Returns for www.nationwidepeptides.com (Nationwide Peptides™)
- [Join Our Affiliate Program](https://www.nationwidepeptides.com/affiliates/): https://youtu.be/d-WYUoY46VU
- [Home](https://www.nationwidepeptides.com/): Our 99%+ pure, third-party-tested peptides drive breakthroughs in biotech, regenerative medicine, and health sciences for US researchers that prioritize excellence and integrity just like us. Choose us for fast nationwide shipping and an unwavering commitment to quality. Learn more about our dedication to the highest quality research peptides.
- [About Us](https://www.nationwidepeptides.com/about-us/): Nationwide Peptides is proud to be a dedicated supplier of lyophilized peptides for pre-clinical applications. Investigators access compounds synthesized in accordance with Good Manufacturing Practice (GMP) guidelines, ensuring peptide-to-peptide consistency. Third-party laboratories perform High-Performance Liquid Chromatography (HPLC) and Mass Spectrometry (MS) on every lot to confirm identity and purity.
- [Shop](https://www.nationwidepeptides.com/shop/)
- [Privacy Policy](https://www.nationwidepeptides.com/privacy-policy/): Privacy Policy – Nationwide Peptides (National Science Labs, LLC)
- [Customer Support](https://www.nationwidepeptides.com/customer-support/): At Nationwide Peptides, we prioritize clear communication and efficient resolution for every investigator. Whether you have questions about tracking, peptide documentation, or order processing, our support team is ready to assist.
- [Contact us](https://www.nationwidepeptides.com/contact-us/): Home

## Products
- [HCG Peptide](https://www.nationwidepeptides.com/products/hcg/): Research-grade HCG (Human Chorionic Gonadotropin) is a recombinant glycoprotein hormone (α + β subunits, 237 amino acids total), intended for controlled laboratory investigations of LH receptor activation, steroidogenesis, and hypothalamic–pituitary–gonadal (HPG) axis signaling, as documented in scientific literature (ncbi.nlm.nih.gov). For Research Use Only. Not for human use.
- [Selank Peptide](https://www.nationwidepeptides.com/products/selank/): For Research Use Only. Not for human use. Research-grade Selank (Thr-Lys-Pro-Arg-Pro-Gly-Pro), a synthetic heptapeptide analog of tuftsin, is designed for controlled laboratory investigations of GABAergic and BDNF modulation, immune function, and related neurochemical pathways.
- [PTD-DBM Peptide](https://www.nationwidepeptides.com/products/ptd-dbm/): For Research Use Only. Not for human use. The high-purity PTD-DBM peptide is designed for advanced laboratory research on hair follicle regeneration and skin repair. PTD-DBM is a synthetic peptide studied for its role in activating the Wnt/β-catenin cell signaling pathway. It is widely referenced in scientific literature exploring hair follicle neogenesis, wound healing mechanisms, and tissue regeneration in preclinical models ().
- [PE-22-28 Peptide](https://www.nationwidepeptides.com/products/pe-22-28/): PE-22-28 is a research-grade synthetic peptide that selectively blocks TREK-1 potassium channels for preclinical studies on neuronal and mood regulation.
- [P21 Peptide](https://www.nationwidepeptides.com/products/p21/): High-purity P21 peptide designed for advanced neurotrophic signaling and neurogenesis research. P21 (also known as P021), a synthetic tetrapeptide mimetic derived from ciliary neurotrophic factor (CNTF), is widely used in scientific studies exploring hippocampal neurogenesis, synaptic plasticity mechanisms, and modulation of neurodegenerative pathways in preclinical models.
- [MGF (Mechano Growth Factor) Peptide](https://www.nationwidepeptides.com/products/mgf-mechano-growth-factor/): Research-grade MGF (Mechano Growth Factor, IGF-1Ec), a synthetic 24-amino-acid splice variant of IGF-1 (Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-His-Lys), intended for controlled laboratory investigations of muscle satellite cell biology, mechano-transduction signaling, and tissue-specific IGF-1 splice variant research. For Research Use Only. Not for human use.
- [Melatonin Peptide](https://www.nationwidepeptides.com/products/melatonin/): For Research Use Only. Not for human use. Research-grade Melatonin (N-acetyl-5-methoxytryptamine), an endogenous indoleamine produced by the pineal gland, is designed for controlled in-vitro and preclinical investigations of circadian rhythm regulation, ROS/RNS scavenging mechanisms, antioxidant defense pathways, mitochondrial protection, and neuroendocrine signaling. Batch-validated for purity, structure, and consistent experimental performance.
- [Melanotan 2 (MT-II) Peptide](https://www.nationwidepeptides.com/products/melanotan-2/): For Research Use Only. Not for human use. Melanotan 2 (MT-2) is a synthetic melanocortin receptor agonist frequently utilized in laboratory settings to study pigmentation pathways, melanocyte signaling, and UV-response models.
- [LC-120 Peptide](https://www.nationwidepeptides.com/products/lc-120/): LC-120 is a research-grade lipotropic blend designed for preclinical studies on liver lipid metabolism, methylation, and fatty acid oxidation.
- [Lipo-C Peptide](https://www.nationwidepeptides.com/products/lipo-c-supplement-blend/): Research-grade Lipo-C blend (Methionine + Inositol + Choline + L-Carnitine + B-Vitamins) is a synthetic lipotropic formulation designed for controlled investigations of fat metabolism, hepatic lipid transport, energy production, and nutrient mobilization pathways. For Research Use Only. Not for human use.
- [KPV Peptide Peptide](https://www.nationwidepeptides.com/products/kpv/): High-purity KPV peptide designed for advanced anti-inflammatory and mucosal barrier research. KPV, a synthetic tripeptide (Lys-Pro-Val) derived from the C-terminal sequence of alpha-melanocyte-stimulating hormone, is widely utilized in scientific studies exploring NF-κB pathway modulation, cytokine regulation, and intestinal epithelial responses in pre-clinical models.
- [L-Carnitine Peptide](https://www.nationwidepeptides.com/products/l-carnitine/): Research-grade L-Carnitine (free base or tartrate form), the biologically active enantiomer of carnitine (β-hydroxy-γ-N-trimethylaminobutyric acid), is designed for controlled laboratory investigations of fatty acid transport, mitochondrial beta-oxidation, energy production, and related metabolic pathways. For Research Use Only. Not for human use.
- [Kisspeptin Peptide](https://www.nationwidepeptides.com/products/kisspeptin/): For Research Use Only. Not for human use. Research-grade Kisspeptin-10 (Metastin 45-54), the minimal 10-amino-acid active core of kisspeptin-54 (Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH₂), intended for controlled laboratory investigations of pulsatile GnRH release, LH/FSH signaling, and hypothalamic–pituitary–gonadal (HPG) axis regulation in research models.
- [Ipamorelin Peptide](https://www.nationwidepeptides.com/products/ipamorelin/): Ipamorelin (Aib-His-D-2-Nal-D-Phe-Lys-NH₂) is a highly selective, synthetic ghrelin mimetic and one of the cleanest growth hormone-releasing peptides available for laboratory research. For Research Use Only. Not for human use.
- [HMG Peptide](https://www.nationwidepeptides.com/products/hmg/): Research-grade HMG (Human Menopausal Gonadotropin) is a recombinant or urinary-derived heterodimeric glycoprotein hormone containing FSH (92 aa) + LH (121 aa) activity.
- [Hexarelin Peptide](https://www.nationwidepeptides.com/products/hexarelin/): Research-grade Hexarelin Acetate (Examorelin), a synthetic hexapeptide (His-D-2-Methyl-Trp-Ala-Trp-D-Phe-Lys-NH₂), is designed for controlled investigations of GH secretagogue receptor activity, GHS-R1a/CD36 dual agonism, and GH pulsatility signaling pathways. For Research Use Only. Not for human use.
- [GHRP-2 Peptide](https://www.nationwidepeptides.com/products/ghrp-2/): For Research Use Only. Not for human use. Research-grade GHRP-2 Acetate (Growth Hormone Releasing Peptide-2), a synthetic hexapeptide (D-Ala-D-β-Nal-Ala-Trp-D-Phe-Lys-NH₂), designed for controlled laboratory investigations of GH pulsatility and GHS-R1a receptor agonism.
- [GHRP-6 Peptide](https://www.nationwidepeptides.com/products/ghrp-6/): For Research Use Only. Not for human use. Research-grade GHRP-6 (Growth Hormone Releasing Peptide-6) is a synthetic hexapeptide (His-D-Trp-Ala-Trp-D-Phe-Lys-NH₂) designed for controlled laboratory investigations of pulsatile GH release mechanisms, GHS-R1a receptor activation, PI turnover in somatotrophs, and related intracellular signaling pathways.
- [GDF-8 Peptide](https://www.nationwidepeptides.com/products/gdf-8/): High-purity GDF-8 peptide designed for advanced myostatin signaling and musculoskeletal regulation research. GDF-8 (myostatin), a member of the TGF-β superfamily, is widely used in scientific studies of the negative regulation of skeletal muscle mass, bone remodeling mechanisms, and tissue pathway characterization in preclinical models. For Research Use Only. Not for human use.
- [Frag 17-23 Peptide](https://www.nationwidepeptides.com/products/frag-17-23/): High-purity TB-500 Fragment (17-23) peptide designed for advanced actin-binding research. TB-500 Frag 17-23 (sequence: LKKTETQ), a synthetic heptapeptide derived from the actin-interaction domain of thymosin beta-4, is widely used in scientific studies of cytoskeletal dynamics, cell migration mechanisms, and regenerative signaling pathways in preclinical models. For Research Use Only. Not for human use.
- [FOXO4-DRI Peptide](https://www.nationwidepeptides.com/products/foxo4-dri/): Research-grade FOXO4-DRI (FOXO4-D-Retro-Inverso) is a synthetic D-retro-inverso octapeptide (Arg-R-Arg-R-Gln-R-Arg-R-Arg), designed for controlled laboratory investigations of FOXO4-p53 disruption, selective clearance of senescent cells, and apoptosis induction in preclinical models. For Research Use Only. Not for human use.
- [Follistatin 344 Peptide](https://www.nationwidepeptides.com/products/follistatin-344/): Research-grade Follistatin 344 (FS-344), a recombinant 344-amino-acid activin-binding glycoprotein, is designed for controlled laboratory investigations of myostatin/activin antagonism, satellite cell biology, and tissue-specific blockade of the TGF-β pathway. For Research Use Only. Not for human use.
- [Dihexa Peptide](https://www.nationwidepeptides.com/products/dihexa/): High-purity Dihexa peptide designed for advanced synaptogenic and cognitive pathway research. Dihexa (N-hexanoic-Tyr-Ile-(6) aminohexanoic amide), a synthetic oligopeptide analog of angiotensin IV, is widely utilized in scientific studies exploring hepatocyte growth factor (HGF)/c-Met receptor potentiation, dendritic spine formation, and synaptic plasticity mechanisms in pre-clinical models.
- [Cardiogen Peptide](https://www.nationwidepeptides.com/products/cardiogen/): High-purity Cardiogen peptide designed for advanced cardiac tissue bioregulation and myocardial research. Cardiogen, a synthetic tetrapeptide (Ala-Glu-Asp-Arg), is widely used in scientific studies of gene expression modulation, cardiomyocyte proliferation mechanisms, and cardiovascular remodeling pathways in preclinical models. For Research Use Only. Not for human use.
- [Bacteriostatic Water (Bac Water)](https://www.nationwidepeptides.com/products/bacteriostatic-water-bac-water/): For Research Use Only. Not for human use. Pharmaceutical-grade Bacteriostatic Water for Injection, USP — 0.9% Benzyl Alcohol-preserved sterile water, specifically formulated for multi-dose peptide reconstitution and research use.
- [AHK-CU Peptide](https://www.nationwidepeptides.com/products/ahk-cu/): For Research Use Only. Not for human use. High-purity AHK-Cu peptide designed for advanced hair follicle biology and dermal papilla cell research. AHK-Cu, a synthetic copper-complexed tripeptide (Ala-His-Lys), is widely used in scientific studies examining vascular endothelial growth factor pathways, follicular cell signaling, and dermal cell behavior in preclinical models.
- [Klow Blend Peptide KPV/GHK-CU/BPC-157/TB-500](https://www.nationwidepeptides.com/products/klow-blend/): High-purity KLOW blend supplied for in vitro and preclinical laboratory research. KLOW is a research formulation combining BPC-157, TB-500, GHK-Cu, and KPV, studied for its constituent peptides’ interactions across molecular signaling pathways related to angiogenesis, extracellular matrix dynamics, cytokine modulation, and cellular migration in preclinical models. For Research Use Only. Not for human use.
- [CJC-1295 (without DAC) Peptide](https://www.nationwidepeptides.com/products/cjc-1295/): High-purity CJC-1295 without DAC is designed for advanced GHRH receptor and pulsatile growth hormone research. CJC-1295 without DAC (modified GRF 1-29), a tetrasubstituted GHRH analog, is widely utilized in scientific studies exploring short-acting pituitary stimulation, synergistic GH dynamics, and somatotropic axis mechanisms in pre-clinical models. For Research Use Only. Not for human use.
- [CJC-1295 + Ipamorelin Blend](https://www.nationwidepeptides.com/products/cjc-1295-ipamorelin-blend/): Research-grade CJC-1295 + Ipamorelin blend is a widely referenced synergistic combination for studying sustained and pulsatile GH release mechanisms in controlled laboratory settings, designed for investigations of IGF-1 signaling, neuroendocrine pathway activation, and somatotropic axis regulation. For Research Use Only. Not for human use.
- [Melanotan 1 Peptide](https://www.nationwidepeptides.com/products/melanotan-1/): For Research Use Only. Not for human use. High-purity Melanotan 1 peptide designed for advanced melanocortin receptor and pigmentation pathway research. Melanotan 1 (also known as -α-MSH or afamelanotide), a synthetic linear tridecapeptide analog of α-melanocyte-stimulating hormone, is widely used in scientific studies exploring MC1R activation, melanin synthesis mechanisms, and photoprotective responses in preclinical models.
- [LC-216 Peptide](https://www.nationwidepeptides.com/products/lc-216/): High-purity LC-216 research compound designed for advanced lipotropic and metabolic pathway research. LC-216, a specialized formulation often referred to as Lipo-C or similar lipotropic blends, incorporates key components such as L-Carnitine, Methionine, Inositol, Choline, and select B-vitamins. It is used in scientific studies exploring lipid metabolism, hepatic function, and mechanisms of fat mobilization in preclinical models. For Research Use Only. Not for human use.
- [Wolverine Blend](https://www.nationwidepeptides.com/products/wolverine-research-blend/): Research-grade Wolverine Blend (BPC-157 5 mg + TB-500 5 mg) is a widely investigated dual-peptide combination studied for angiogenesis signaling, cytoskeletal dynamics, collagen deposition pathway characterization, gastrointestinal mucosal pathway research, inflammation modulation, and multi-tissue remodeling in controlled laboratory and preclinical model settings. For Research Use Only. Not for human use.
- [Cagrisema Peptide](https://www.nationwidepeptides.com/products/cagrisema/): High-purity CagriSema peptide designed for advanced dual amylin/GLP-1 receptor and metabolic regulation research. CagriSema is a fixed-dose co-formulation combining a long-acting amylin analogue with a GLP-1 receptor agonist, widely used in scientific studies exploring synergistic receptor signaling, glucose homeostasis mechanisms, and metabolic pathway dynamics in preclinical models. For Research Use Only. Not for human use.
- [Adamax Peptide Peptide](https://www.nationwidepeptides.com/products/adamax/): High-purity Adamax peptide is designed for advanced research on neurotrophic signaling and neuroplasticity. Adamax, a synthetic heptapeptide analog of Semax with an adamantane modification (Ac-MEHFPGP-AG-NH2), is widely used in scientific studies exploring BDNF expression, TrkB receptor sensitivity, and synaptic plasticity mechanisms in preclinical models. For Research Use Only. Not for human use.
- [Gonadorelin Peptide](https://www.nationwidepeptides.com/products/gonadorelin/): Research-grade Gonadorelin Peptide (GnRH, LHRH), a synthetic decapeptide identical to endogenous gonadotropin-releasing hormone, designed for controlled investigations of pituitary LH/FSH release, hypothalamic–pituitary–gonadal (HPG) axis function, fertility regulation, and pulsatile hormone signaling. For Research Use Only. Not for human use.
- [Glutathione Peptide](https://www.nationwidepeptides.com/products/glutathione/): For Research Use Only. Not for human use. Research-grade Glutathione (γ-Glu-Cys-Gly, reduced form), the master intracellular tripeptide antioxidant, is designed for controlled in-vitro investigations of redox homeostasis, ROS/RNS scavenging, phase II detoxification pathway studies, and mitochondrial redox signaling research.
- [SLU-PP-332 Peptide](https://www.nationwidepeptides.com/products/slu-pp-332/): For Research Use Only. Not for human use. Research-grade SLU-PP-332 (CAS 303760-60-3), a synthetic small-molecule pan-agonist of estrogen-related receptors (ERRα/β/γ), is intended solely for controlled laboratory investigations of ERR-mediated signaling, mitochondrial biogenesis, fatty acid oxidation pathways, and related metabolic mechanisms in preclinical research models.
- [Cerebrolysin Peptide](https://www.nationwidepeptides.com/products/cerebrolysin/): Research-grade Cerebrolysin Peptide is a porcine-brain-derived neurotrophic peptide mixture (≈ 85% free amino acids + 15% low-molecular-weight peptides <10 kDa). For Research Use Only. Not for human use.
- [VIP (Vasoactive Intestinal Peptide) Peptide](https://www.nationwidepeptides.com/products/vip-vasoactive-intestinal-peptide/): For Research Use Only. Not for Human Use. Research-grade VIP (Vasoactive Intestinal Peptide) is a synthetic 28-amino-acid neuropeptide identical to endogenous VIP, designed for controlled laboratory investigations of smooth muscle relaxation, vasodilation, neuroendocrine signaling, gastrointestinal motility, and anti-inflammatory pathway research.
- [Pinealon Peptide](https://www.nationwidepeptides.com/products/pinealon/): Research-grade Pinealon (Glu-Asp-Arg) is a synthetic tripeptide for controlled laboratory investigations of neuronal survival, BDNF modulation, pineal gland biology, and circadian rhythm regulation in preclinical and in vitro research models. For Research Use Only. Not for human use.
- [SS-31 (Elamipretide) Peptide](https://www.nationwidepeptides.com/products/ss-31elamipretide/): For Research Use Only. Not for Human Use. Research-grade SS-31 (Elamipretide, MTP-131), a synthetic Szeto-Schiller tetrapeptide (D-Arg-Dmt-Lys-Phe-NH₂), is designed for controlled in vitro and preclinical investigations of mitochondrial cardiolipin stabilization, ROS modulation, ATP preservation, and mitochondrial membrane dynamics in ischemia-reperfusion, neurodegenerative, and metabolic in vitro research models.
- [PNC-27 Peptide](https://www.nationwidepeptides.com/products/pnc-27/): Research-grade PNC-27 is a synthetic 32-amino-acid chimeric peptide containing p53 residues 12-26 fused to a membrane residency peptide (MRP). For Research Use Only. Not for human use.
- [LL-37 (Cathelicidin) Peptide](https://www.nationwidepeptides.com/products/ll-37-cathelicidin/): For Research Use Only. Not for human use. Research-grade LL-37 (Cathelicidin, CAP-18) is the human 37-amino-acid antimicrobial peptide ([LL-37, 37 aa]), intended for controlled in vitro investigations of innate immunity mechanisms, microbial membrane disruption, inflammatory signaling modulation, and epithelial defense pathways in laboratory settings.
- [Epithalon Peptide](https://www.nationwidepeptides.com/products/epithalon/): For Research Use Only. Not for human use. Research-grade Epithalon (Epitalon, Ala-Glu-Asp-Gly), a synthetic tetrapeptide derived from epithalamin (pineal gland extract), is intended for controlled laboratory investigations of telomerase activity, telomere dynamics, pineal function, and cellular aging pathways (pmc.ncbi.nlm.nih.gov).
- [IGF-1 LR3 Peptide](https://www.nationwidepeptides.com/products/igf-1-lr3/): Research-grade IGF-1 LR3 (Long R³ Insulin-Like Growth Factor-1) is an 83-amino-acid recombinant analog of human IGF-1 with arginine substitution at position 3 and a 13-amino-acid N-terminal extension. It has sequence integrity and consistent experimental performance. For Research Use Only. Not for human use.
- [Tesamorelin Peptide](https://www.nationwidepeptides.com/products/tesamorelin/): Research-grade Tesamorelin Acetate (TH9507, Egrifta®) is a synthetic 44-amino-acid growth hormone-releasing hormone (GHRH) analog with N-terminal trans-3-hexenoyl modification. For Research Use Only. Not for human use.
- [Thymalin Peptide](https://www.nationwidepeptides.com/products/thymalin/): For Research Use Only. Not for human use. Research-grade Thymalin (thymic polypeptide complex) is a synthetic mixture modeled after calf thymus-derived peptides, designed for controlled in vitro and preclinical investigations of thymic factor activity, T-cell differentiation, immune signaling, and immunosenescence-related pathways.
- [Thymosin Alpha-1 Peptide](https://www.nationwidepeptides.com/products/thymosin-alpha-1/): For Research Use Only. Not for human use. Research-grade Thymosin Alpha-1 (Tα1), a synthetic 28-amino-acid thymic peptide (Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH), is designed for controlled investigations of T-cell maturation, NK cell activation, dendritic cell function, cytokine balance, and broad-spectrum antiviral/immunomodulatory pathways.
- [MOTS-C Peptide](https://www.nationwidepeptides.com/products/mots-c/): For Research Use Only. Not for human use. Research-grade MOTS-c (Mitochondrial Open Reading Frame of the 12S rRNA type-c) is a 16-amino-acid mitochondrial-derived peptide (MRPSLLRSPPGLAWLRLFG), intended for controlled laboratory investigations of AMPK activation, glucose metabolism pathways, and mitochondrial retrograde signaling.
- [5-Amino-1MQ Peptide](https://www.nationwidepeptides.com/products/5-amino-1mq/): Research-grade 5-Amino-1MQ (5-amino-1-methylquinolinium) is a potent, selective, small-molecule inhibitor of nicotinamide N-methyltransferase (NNMT). For Research Use Only. Not for human use.

## Peptides
- [GLP-1 Agonist Meds in 2026: Comprehensive Evidence Review of Efficacy, Safety, and Uses](https://www.nationwidepeptides.com/peptide/glp-1-agonists-2026-review-2/)
- [GLP-1 Meds in 2026: Efficacy, Safety, FDA Approvals, and Latest Evidence](https://www.nationwidepeptides.com/peptide/glp-1-meds-2026-efficacy-safety/)
- [AOD9604 in 2026: Efficacy, Safety, and Regulatory Status from the Latest Evidence](https://www.nationwidepeptides.com/peptide/aod9604-2026-efficacy-safety/)
- [Peptides for Muscle Growth in 2026: Evidence, Safety, and FDA Status](https://www.nationwidepeptides.com/peptide/peptides-muscle-growth-2026/)
- [Ipamorelin in 2026: Mechanisms, Uses, Safety, and Latest Clinical Evidence](https://www.nationwidepeptides.com/peptide/ipamorelin-2026-review/)
- [GHK Copper Peptides in 2026: Evidence-Based Review of Benefits, Mechanisms, and Safety](https://www.nationwidepeptides.com/peptide/ghk-cu-peptides-2026-review/)
- [Copper Peptide GHK-Cu in 2026: Evidence-Based Review of Mechanisms, Benefits, and Safety](https://www.nationwidepeptides.com/peptide/ghk-cu-2026-review/)
- [GHK-Cu in 2026: Benefits, Mechanisms, Safety, and Latest Evidence](https://www.nationwidepeptides.com/peptide/ghk-cu-2026-benefits-safety/)
- [CJC-1295 in 2026: Evidence-Based Review of Mechanism, Uses, Safety, and FDA Status](https://www.nationwidepeptides.com/peptide/cjc-1295-2026-review/)
- [GLP-1 Agonist Research: Mechanisms, Evidence, and Future Directions](https://www.nationwidepeptides.com/peptide/glp-1-agonist-research-2/)
- [GLP-1 Inhibitors](https://www.nationwidepeptides.com/peptide/glp-1-inhibitors/)
- [GLP-1 Agonist Research: Mechanisms, Evidence, and Future Directions](https://www.nationwidepeptides.com/peptide/glp-1-agonist-research/)
- [Cheapest GLP-1 Peptides: Insights from Peer-Reviewed Research on Glucagon-Like Peptide-1](https://www.nationwidepeptides.com/peptide/cheapest-glp-1-peptides-research/)
- [Reddit GLP-1: Peer-Reviewed Insights into Glucagon-Like Peptide-1 Research](https://www.nationwidepeptides.com/peptide/reddit-glp-1-research/)
- [Sermorelin Online: Peer-Reviewed Insights into Growth Hormone-Releasing Hormone Analog Research](https://www.nationwidepeptides.com/peptide/sermorelin-online-research/)
- [RO GLP-1: Insights from Peer-Reviewed Research on Glucagon-Like Peptide-1 Receptor Agonists](https://www.nationwidepeptides.com/peptide/ro-glp-1-research/)
- [GLP-1 Online: Peer-Reviewed Research on Glucagon-Like Peptide-1](https://www.nationwidepeptides.com/peptide/glp-1-online-research-2/)
- [GLP-1 Online: Insights into Glucagon-Like Peptide-1 Research](https://www.nationwidepeptides.com/peptide/glp-1-online-research/)
- [Roman GLP-1: Peer-Reviewed Research on Glucagon-Like Peptide-1](https://www.nationwidepeptides.com/peptide/roman-glp-1-research/)
- [Mounjaro GLP-1 Agonist Research: Insights from Peer-Reviewed Studies](https://www.nationwidepeptides.com/peptide/mounjaro-glp-1-agonist-research/)
- [Sermorelin Injections: Research Insights on Sermorelin Peptide Studies](https://www.nationwidepeptides.com/peptide/sermorelin-injections-research/)
- [Sermorelin Research: Insights from Peer-Reviewed Studies](https://www.nationwidepeptides.com/peptide/order-sermorelin-online/)
- [Insights from Peer-Reviewed Research on Glucagon-Like Peptide-1](https://www.nationwidepeptides.com/peptide/glp-1-research-insights/)
- [GLP-1 Agonists for Type 2 Diabetes: An Evidence-Based Research Overview](https://www.nationwidepeptides.com/peptide/glp-1-agonists-for-type-2-diabetes/)
- [GLP-1 Receptor Agonists for Type 2 Diabetes: An Evidence-Based Research Overview](https://www.nationwidepeptides.com/peptide/glp-1-receptor-agonists-for-type-2-diabetes/)
- [Dipeptide Research: Mechanisms, Evidence, and Potential Directions](https://www.nationwidepeptides.com/peptide/dipeptide-research/)
- [ANP Peptide: Insights from Peer-Reviewed Research on Structure, Function, and Potential Roles](https://www.nationwidepeptides.com/peptide/anp-peptide-research/)
- [GHK-Cu Peptide: Insights from Peer-Reviewed Research](https://www.nationwidepeptides.com/peptide/ghk-cu-peptide-research/)
- [TB500: Insights from Thymosin Beta-4 Research](https://www.nationwidepeptides.com/peptide/tb500-thymosin-beta-4-research/)
- [Fat Loss Peptides: 15-20% Weight Reduction in Clinical Trials – A Comprehensive Review](https://www.nationwidepeptides.com/peptide/fat-loss-peptides-review/)
- [Peptides for Weight Loss: 10 Key Insights from Clinical Trials](https://www.nationwidepeptides.com/peptide/peptides-for-weight-loss/)
- [BPC-157 Peptide: 10 Key Preclinical Insights on Tissue Protection](https://www.nationwidepeptides.com/peptide/bpc-157-peptide-review-2/)
- [BPC 157 Peptide: 10 Studies Reveal Preclinical Healing Insights and Challenges](https://www.nationwidepeptides.com/peptide/bpc-157-peptide-review/)
- [7 Revolutionary Advances in Peptide Science Transforming Modern Medicine](https://www.nationwidepeptides.com/peptide/peptide-science-advances-2026/)
- [GLP-1 Medications: 12 Evidence-Based Insights for Metabolic Health](https://www.nationwidepeptides.com/peptide/glp-1-medications-review/)
- [GLP-1 Medications: 11 Key Insights from Clinical Research](https://www.nationwidepeptides.com/peptide/glp-1-medications/)
- [GLP-1 Receptor Agonists: What They Are and 10 Key Mechanisms and Applications](https://www.nationwidepeptides.com/peptide/glp-1-receptor-agonists/)
- [GLP-1 Drugs: 12-20% Weight Loss in Clinical Studies – A Comprehensive Review](https://www.nationwidepeptides.com/peptide/glp-1-drugs-review-2/)
- [GLP-1 Receptor Agonist Medicines: 10 Key Insights from Recent Research](https://www.nationwidepeptides.com/peptide/glp1-agonists-review/)
- [GLP-1 Drugs: 10 Key Insights from Clinical Trials and Meta-Analyses](https://www.nationwidepeptides.com/peptide/glp-1-drugs-review/)
- [Sermorelin: Mechanisms, Clinical Applications, and Research Insights](https://www.nationwidepeptides.com/peptide/sermorelin-applications/)
- [GLP1 Meds: Mechanisms, Clinical Evidence, and Research Directions (Added video prompt generation)](https://www.nationwidepeptides.com/peptide/glp1-meds/)
- [GLP-1 Receptor Agonists: A Comprehensive Review (Needs to be converted to html)](https://www.nationwidepeptides.com/peptide/glp-1-receptor-agonists-comprehensive-review/)
- [GLP1 Meds: Research on Mechanisms and Clinical Trial Findings](https://www.nationwidepeptides.com/peptide/glp-1-meds/)
- [GLP-1 Receptor Agonists: A Comprehensive Review of Mechanisms and Clinical Insights](https://www.nationwidepeptides.com/peptide/glp-1-receptor-agonists-review-2/)
- [GLP-1 Receptor Agonists: Mechanisms, Clinical Evidence, and Future Directions](https://www.nationwidepeptides.com/peptide/glp1-receptor-agonists-review/):  
- [BPC-157: Preclinical Research Insights on Tissue Protection and Repair Mechanisms](https://www.nationwidepeptides.com/peptide/bpc-157-review/)
- [Peptite: An Overview of Peptide Therapeutics Research](https://www.nationwidepeptides.com/peptide/peptite-peptide-therapeutics-research-review/)
- [Therapeutic Peptides: Current Applications, Mechanisms, and Future Directions](https://www.nationwidepeptides.com/peptide/therapeutic-peptides-current-applications-future-directions/)
- [Retatrutide: Emerging Research on a Triple Agonist for Metabolic Health](https://www.nationwidepeptides.com/peptide/retatrutide-review/)

## Categories

## Brands

## Product categories

## Product tags